Lineage for d3coqa1 (3coq A:8-48)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035544Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
    all-alpha dimetal(zinc)-bound fold
  4. 3035545Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
    duplication: two structural repeats are related by the pseudo dyad
  5. 3035546Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 3035556Protein Gal4 [57703] (1 species)
  7. 3035557Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57704] (3 PDB entries)
  8. 3035558Domain d3coqa1: 3coq A:8-48 [156873]
    Other proteins in same PDB: d3coqa2, d3coqb2
    automatically matched to d1d66a1
    protein/DNA complex; complexed with mpd, zn

Details for d3coqa1

PDB Entry: 3coq (more details), 2.4 Å

PDB Description: structural basis for dimerization in dna recognition by gal4
PDB Compounds: (A:) regulatory protein gal4

SCOPe Domain Sequences for d3coqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3coqa1 g.38.1.1 (A:8-48) Gal4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eqacdicrlkklkcskekpkcakclknnwecryspktkrsp

SCOPe Domain Coordinates for d3coqa1:

Click to download the PDB-style file with coordinates for d3coqa1.
(The format of our PDB-style files is described here.)

Timeline for d3coqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3coqa2