Lineage for d1h7xa1 (1h7x A:2-183)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1256293Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 1256342Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein)
  6. 1256343Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species)
    includes the N-terminal tail and the linker to domain 2
  7. 1256344Species Pig (Sus scrofa) [TaxId:9823] [46555] (5 PDB entries)
  8. 1256353Domain d1h7xa1: 1h7x A:2-183 [15687]
    Other proteins in same PDB: d1h7xa2, d1h7xa3, d1h7xa4, d1h7xa5, d1h7xb2, d1h7xb3, d1h7xb4, d1h7xb5, d1h7xc2, d1h7xc3, d1h7xc4, d1h7xc5, d1h7xd2, d1h7xd3, d1h7xd4, d1h7xd5
    complexed with fad, fmn, ndp, sf4, urf; mutant

Details for d1h7xa1

PDB Entry: 1h7x (more details), 2.01 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex of a mutant enzyme (c671a), nadph and 5-fluorouracil
PDB Compounds: (A:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1h7xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7xa1 a.1.2.2 (A:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
mp

SCOPe Domain Coordinates for d1h7xa1:

Click to download the PDB-style file with coordinates for d1h7xa1.
(The format of our PDB-style files is described here.)

Timeline for d1h7xa1: