Lineage for d3cojf2 (3coj F:1760-1855)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1836776Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1836777Superfamily c.15.1: BRCT domain [52113] (6 families) (S)
    Pfam PF00533
  5. 1836806Family c.15.1.3: BRCT domain [63955] (1 protein)
  6. 1836807Protein Breast cancer associated protein, BRCA1 [63956] (2 species)
    duplication: tandem repeat of BRCT domain
  7. 1836808Species Human (Homo sapiens) [TaxId:9606] [63957] (15 PDB entries)
    Uniprot P38398 1649-1863
  8. 1836842Domain d3cojf2: 3coj F:1760-1855 [156868]
    automatically matched to d1l0ba2
    protein/DNA complex

Details for d3cojf2

PDB Entry: 3coj (more details), 3.21 Å

PDB Description: crystal structure of the brct domains of human brca1 in complex with a phosphorylated peptide from human acetyl-coa carboxylase 1
PDB Compounds: (F:) breast cancer type 1 susceptibility protein

SCOPe Domain Sequences for d3cojf2:

Sequence, based on SEQRES records: (download)

>d3cojf2 c.15.1.3 (F:1760-1855) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]}
ifrgleiccygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpdawtedn
gfhaigqmceapvvtrewvldsvalyqcqeldtyli

Sequence, based on observed residues (ATOM records): (download)

>d3cojf2 c.15.1.3 (F:1760-1855) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]}
ifrgleiccygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpdawtgfh
aigqmceapvvtrewvldsvalyqcqeldtyli

SCOPe Domain Coordinates for d3cojf2:

Click to download the PDB-style file with coordinates for d3cojf2.
(The format of our PDB-style files is described here.)

Timeline for d3cojf2: