SCOPe 2.05: Domain d3coje2: 3coj E:1760-1855

Lineage for d3coje2 (3coj E:1760-1855)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.15: BRCT domain [52112] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.15.1: BRCT domain [52113] (6 families)
   Pfam PF00533

5. Family c.15.1.3: BRCT domain [63955] (1 protein)

6. Protein Breast cancer associated protein, BRCA1 [63956] (2 species)
   duplication: tandem repeat of BRCT domain

7. Species Human (Homo sapiens) [TaxId:9606] [63957] (15 PDB entries)
   Uniprot P38398 1649-1863

8. Domain d3coje2: 3coj E:1760-1855 [156866]
   automatically matched to d1l0ba2
   protein/DNA complex

Details for d3coje2

PDB Entry: 3coj, 3.21 Å

PDB Description: crystal structure of the brct domains of human brca1 in complex with a phosphorylated peptide from human acetyl-coa carboxylase 1

PDB Compounds: (E:) breast cancer type 1 susceptibility protein

SCOPe Domain Sequences for d3coje2:

Sequence, based on SEQRES records:

>d3coje2 c.15.1.3 (E:1760-1855) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]}
ifrgleiccygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpdawtedn
gfhaigqmceapvvtrewvldsvalyqcqeldtyli

Sequence, based on observed residues (ATOM records):

>d3coje2 c.15.1.3 (E:1760-1855) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]}
ifrgleiccygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpdawtgfh
aigqmceapvvtrewvldsvalyqcqeldtyli

Timeline for d3coje2:

• d3coje2 first appeared in SCOP 1.75
  
• d3coje2 appears in SCOPe 2.04
  
• d3coje2 appears in SCOPe 2.06
  
• d3coje2 appears in the current release, SCOPe 2.08