| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.15: BRCT domain [52112] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.15.1: BRCT domain [52113] (6 families) ![]() Pfam PF00533 |
| Family c.15.1.3: BRCT domain [63955] (1 protein) |
| Protein Breast cancer associated protein, BRCA1 [63956] (2 species) duplication: tandem repeat of BRCT domain |
| Species Human (Homo sapiens) [TaxId:9606] [63957] (15 PDB entries) Uniprot P38398 1649-1863 |
| Domain d3cojd1: 3coj D:1650-1756 [156863] automatically matched to d1l0ba1 protein/DNA complex |
PDB Entry: 3coj (more details), 3.21 Å
SCOPe Domain Sequences for d3cojd1:
Sequence, based on SEQRES records: (download)
>d3cojd1 c.15.1.3 (D:1650-1756) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]}
msmvvsgltpeefmlvykfarkhhitltnliteetthvvmktdaefvcertlkyflgiag
gkwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresq
>d3cojd1 c.15.1.3 (D:1650-1756) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]}
msmvvsgltpeefmlvykfarkhhitltnliteetthvvmktdafvcertlkyflgiagg
kwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresq
Timeline for d3cojd1: