Lineage for d3cojd1 (3coj D:1650-1756)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2462723Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2462724Superfamily c.15.1: BRCT domain [52113] (6 families) (S)
    Pfam PF00533
  5. 2462757Family c.15.1.3: BRCT domain [63955] (1 protein)
  6. 2462758Protein Breast cancer associated protein, BRCA1 [63956] (2 species)
    duplication: tandem repeat of BRCT domain
  7. 2462759Species Human (Homo sapiens) [TaxId:9606] [63957] (15 PDB entries)
    Uniprot P38398 1649-1863
  8. 2462798Domain d3cojd1: 3coj D:1650-1756 [156863]
    automatically matched to d1l0ba1
    protein/DNA complex

Details for d3cojd1

PDB Entry: 3coj (more details), 3.21 Å

PDB Description: crystal structure of the brct domains of human brca1 in complex with a phosphorylated peptide from human acetyl-coa carboxylase 1
PDB Compounds: (D:) breast cancer type 1 susceptibility protein

SCOPe Domain Sequences for d3cojd1:

Sequence, based on SEQRES records: (download)

>d3cojd1 c.15.1.3 (D:1650-1756) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]}
msmvvsgltpeefmlvykfarkhhitltnliteetthvvmktdaefvcertlkyflgiag
gkwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresq

Sequence, based on observed residues (ATOM records): (download)

>d3cojd1 c.15.1.3 (D:1650-1756) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]}
msmvvsgltpeefmlvykfarkhhitltnliteetthvvmktdafvcertlkyflgiagg
kwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresq

SCOPe Domain Coordinates for d3cojd1:

Click to download the PDB-style file with coordinates for d3cojd1.
(The format of our PDB-style files is described here.)

Timeline for d3cojd1: