![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.17: SAV4671-like [159996] (1 protein) PfamB PB000442; uncertain annotation of some members as 3-dehydroquinate dehydratase |
![]() | Protein Uncharacterized protein SAV4671 [159997] (1 species) |
![]() | Species Streptomyces avermitilis [TaxId:33903] [159998] (1 PDB entry) Uniprot Q82EE4 5-157 |
![]() | Domain d3cnxb_: 3cnx B: [156851] automated match to d3cnxa1 complexed with cl, gol, mg, peg, pg6, pge, unl |
PDB Entry: 3cnx (more details), 2.1 Å
SCOPe Domain Sequences for d3cnxb_:
Sequence, based on SEQRES records: (download)
>d3cnxb_ d.17.4.17 (B:) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} pdtdveqvglantafyeamergdfetlsslwltpadlgvdeeyhdpadagvvscvhpgwp vlsgrgevlrsyalimanteyiqffltdvhvsvtgdtalvtctenilsggpppddsdelg plvgqlvvatnvfrrtpdgwklwshhaspvla
>d3cnxb_ d.17.4.17 (B:) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} pdtdveqvglantafyeamergdfetlsslwltpadlgvpadagvvscvhpgwpvlsgrg evlrsyalimanteyiqffltdvhvsvtgdtalvtctenilsggpppddsdelgplvgql vvatnvfrrtpdgwklwshhaspvla
Timeline for d3cnxb_: