Lineage for d3cnxa1 (3cnx A:5-157)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937044Family d.17.4.17: SAV4671-like [159996] (1 protein)
    PfamB PB000442; uncertain annotation of some members as 3-dehydroquinate dehydratase
  6. 2937045Protein Uncharacterized protein SAV4671 [159997] (1 species)
  7. 2937046Species Streptomyces avermitilis [TaxId:33903] [159998] (1 PDB entry)
    Uniprot Q82EE4 5-157
  8. 2937047Domain d3cnxa1: 3cnx A:5-157 [156850]
    complexed with cl, gol, mg, peg, pg6, pge, unl

Details for d3cnxa1

PDB Entry: 3cnx (more details), 2.1 Å

PDB Description: crystal structure of a putative dehydratase from the ntf2-like family (sav_4671) from streptomyces avermitilis at 2.10 a resolution
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d3cnxa1:

Sequence, based on SEQRES records: (download)

>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]}
tpdtdveqvglantafyeamergdfetlsslwltpadlgvdeeyhdpadagvvscvhpgw
pvlsgrgevlrsyalimanteyiqffltdvhvsvtgdtalvtctenilsggpppddsdel
gplvgqlvvatnvfrrtpdgwklwshhaspvla

Sequence, based on observed residues (ATOM records): (download)

>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]}
tpdtdveqvglantafyeamergdfetlsslwltpadlgvpadagvvscvhpgwpvlsgr
gevlrsyalimanteyiqffltdvhvsvtgdtalvtctenilsgggplvgqlvvatnvfr
rtpdgwklwshhaspvla

SCOPe Domain Coordinates for d3cnxa1:

Click to download the PDB-style file with coordinates for d3cnxa1.
(The format of our PDB-style files is described here.)

Timeline for d3cnxa1: