Lineage for d3cnwa1 (3cnw A:3-140)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872733Superfamily d.129.3: Bet v1-like [55961] (10 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 872930Family d.129.3.8: Atu1531-like [160742] (2 proteins)
    Pfam PF10604; Polyketide cyclase/dehydrase and lipid transport
  6. 872935Protein Uncharacterized protein XoxI [160743] (1 species)
  7. 872936Species Bacillus cereus [TaxId:1396] [160744] (1 PDB entry)
    Uniprot Q81AY6 3-140
  8. 872937Domain d3cnwa1: 3cnw A:3-140 [156848]

Details for d3cnwa1

PDB Entry: 3cnw (more details), 2.48 Å

PDB Description: Three-dimensional structure of the protein XoxI (Q81AY6) from Bacillus cereus. Northeast Structural Genomics Consortium target BcR196.
PDB Compounds: (A:) Protein XoxI

SCOP Domain Sequences for d3cnwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]}
mahtttsmeifgspeqvwqliggfnslpdwlpyipssklteggrvrhlanpdgdtiierl
evfndkeryytysimnapfpvtnylstiqvkegtesntslvewsgtftpvevsdeeainl
fhgiysdglkalqqafld

SCOP Domain Coordinates for d3cnwa1:

Click to download the PDB-style file with coordinates for d3cnwa1.
(The format of our PDB-style files is described here.)

Timeline for d3cnwa1: