Lineage for d3cnja1 (3cnj A:9-318,A:451-506)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109341Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2109342Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2109396Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2109397Protein Cholesterol oxidase of GMC family [51914] (3 species)
  7. 2109401Species Streptomyces sp. (strain SA-COO) (Streptomyces sp. SA-COO) [TaxId:74576] [159428] (1 PDB entry)
  8. 2109402Domain d3cnja1: 3cnj A:9-318,A:451-506 [156842]
    Other proteins in same PDB: d3cnja2
    automatically matched to d1ijha1
    complexed with fad, so4; mutant

Details for d3cnja1

PDB Entry: 3cnj (more details), 0.95 Å

PDB Description: cholesterol oxidase from streptomyces sp. f359w mutant (0.95a)
PDB Compounds: (A:) cholesterol oxidase

SCOPe Domain Sequences for d3cnja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cnja1 c.3.1.2 (A:9-318,A:451-506) Cholesterol oxidase of GMC family {Streptomyces sp. (strain SA-COO) (Streptomyces sp. SA-COO) [TaxId: 74576]}
gyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdkrsswf
knrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggmavepkr
syfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagkaglgt
vfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvtiqtlh
qvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrardtgtlp
nlnsevgagwXgcvlgkatddygrvagyknlyvtdgslipgsvgvnpfvtitalaernve
riikqdv

SCOPe Domain Coordinates for d3cnja1:

Click to download the PDB-style file with coordinates for d3cnja1.
(The format of our PDB-style files is described here.)

Timeline for d3cnja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cnja2