Lineage for d1h7wb1 (1h7w B:2-183)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1718664Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 1718742Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein)
  6. 1718743Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species)
    includes the N-terminal tail and the linker to domain 2
  7. 1718744Species Pig (Sus scrofa) [TaxId:9823] [46555] (5 PDB entries)
  8. 1718750Domain d1h7wb1: 1h7w B:2-183 [15684]
    Other proteins in same PDB: d1h7wa2, d1h7wa3, d1h7wa4, d1h7wa5, d1h7wb2, d1h7wb3, d1h7wb4, d1h7wb5, d1h7wc2, d1h7wc3, d1h7wc4, d1h7wc5, d1h7wd2, d1h7wd3, d1h7wd4, d1h7wd5
    complexed with fad, fmn, sf4

Details for d1h7wb1

PDB Entry: 1h7w (more details), 1.9 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig
PDB Compounds: (B:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1h7wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7wb1 a.1.2.2 (B:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
mp

SCOPe Domain Coordinates for d1h7wb1:

Click to download the PDB-style file with coordinates for d1h7wb1.
(The format of our PDB-style files is described here.)

Timeline for d1h7wb1: