SCOPe 2.07: Domain d3cmol2: 3cmo L:108-211

Lineage for d3cmol2 (3cmo L:108-211)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (565 PDB entries)

8. Domain d3cmol2: 3cmo L:108-211 [156838]
   Other proteins in same PDB: d3cmoh1, d3cmol1, d3cmox1, d3cmoy1
   automated match to d4m43l2

Details for d3cmol2

PDB Entry: 3cmo, 2.3 Å

PDB Description: hiv neutralizing monoclonal antibody yz18

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d3cmol2:

Sequence; same for both SEQRES and ATOM records:

>d3cmol2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d3cmol2:

• d3cmol2 first appeared in SCOP 1.75
  
• d3cmol2 appears in SCOPe 2.06