SCOPe 2.08: Domain d3cmoh_: 3cmo H:

Lineage for d3cmoh_ (3cmo H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d3cmoh_: 3cmo H: [156836]
   Other proteins in same PDB: d3cmol1, d3cmol2, d3cmox1, d3cmox2
   automated match to d6shgh_

Details for d3cmoh_

PDB Entry: 3cmo, 2.3 Å

PDB Description: hiv neutralizing monoclonal antibody yz18

PDB Compounds: (H:) Fab heavy chain

SCOPe Domain Sequences for d3cmoh_:

Sequence; same for both SEQRES and ATOM records:

>d3cmoh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avqlsqsgtvlarpgasvkmsckasgytftsywmhwvkqrpgqglewigaiypgnsdtsy
nqkfkgkakltavtsastaymelssltnedsavyyctrwphyyggsryyfdywgqgttlt
vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

Timeline for d3cmoh_:

• d3cmoh_ first appeared in SCOP 1.75, called d3cmoh1
  
• d3cmoh_ was called d3cmoh1 in SCOPe 2.07