![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.16: Caur0242-like [160552] (1 protein) Pfam PF10103; DUF2342; there is a characteristic HExxH motif but no metal ion bound to it in the first structure. |
![]() | Protein Uncharacterized protein Caur0242 [160553] (1 species) |
![]() | Species Chloroflexus aurantiacus [TaxId:1108] [160554] (1 PDB entry) Uniprot A9WCA2 43-391 |
![]() | Domain d3cmna1: 3cmn A:43-391 [156835] Other proteins in same PDB: d3cmna2 |
PDB Entry: 3cmn (more details), 2.25 Å
SCOPe Domain Sequences for d3cmna1:
Sequence, based on SEQRES records: (download)
>d3cmna1 d.92.1.16 (A:43-391) Uncharacterized protein Caur0242 {Chloroflexus aurantiacus [TaxId: 1108]} lidweqarqaalrlsqweqapvdnrafrreqyarmvalsepliadylgvrlpepvsrifv fdrrewleanivsfsqlfrpieemyekngggrgalgvlmndvsskllgvqiggllgylaq rvlgqydlsllsaeatggslyfvepniarvqqqlglsdedfrlwitlhemthafefeayp wvrtyfrelleqnfalvsgqmlssgnslvdmlmrllqgigsgqhwietvltpeqravfdr iqalmsliegygnhvmnavgrrllpsfnqieqqiaqrqrqrtmldqmvfrltgldlklaq yqqgeafvnavvaargiqfasrvwerpenlpsmdeirnpgqwivrm
>d3cmna1 d.92.1.16 (A:43-391) Uncharacterized protein Caur0242 {Chloroflexus aurantiacus [TaxId: 1108]} lidweqarqaalrlsqweqapvdnrafrreqyarmvalsepliadylgvrlpepvsrifv fdrrewleanivsfsqlfrpieemyeksskllgvqiggllgylaqrvlgqydlsllsagg slyfvepniarvqqqlglsdedfrlwitlhemthafefeaypwvrtyfrelleqnfaltp eqravfdriqalmsliegygnhvmnavgrrllpsfnqieqqiaqrqrqrtmldqmvfrlt gldlklaqyqqgeafvnavvaargiqfasrvwerpenlpsmdeirnpgqwivrm
Timeline for d3cmna1: