![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
![]() | Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) ![]() |
![]() | Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein) contains irregular N-terminal extension to the common fold |
![]() | Protein Ribosomal protein L32e [52044] (1 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries) Uniprot P12736 |
![]() | Domain d3cmey1: 3cme Y:95-236 [156831] Other proteins in same PDB: d3cme11, d3cme21, d3cme31, d3cmeb1, d3cmed1, d3cmef1, d3cmeg1, d3cmeh1, d3cmei1, d3cmej1, d3cmek1, d3cmel1, d3cmen1, d3cmeo1, d3cmep1, d3cmeq1, d3cmer1, d3cmes1, d3cmet1, d3cmeu1, d3cmev1, d3cmew1, d3cmex1, d3cmez1 automatically matched to d1jj2x_ protein/RNA complex; complexed with cd, cl, k, mg, na, phe, sr |
PDB Entry: 3cme (more details), 2.95 Å
SCOPe Domain Sequences for d3cmey1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cmey1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]} telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr erieeeaedagirvlnptyvev
Timeline for d3cmey1: