Lineage for d3cmeu1 (3cme U:4-56)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1070374Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1070375Protein 50S subunit [58125] (6 species)
  7. 1070524Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1070760Domain d3cmeu1: 3cme U:4-56 [156827]
    Other proteins in same PDB: d3cme21, d3cmeb1, d3cmef1, d3cmeg1, d3cmeh1, d3cmei1, d3cmep1, d3cmer1, d3cmes1, d3cmey1, d3cmez1
    automatically matched to d1w2bt_
    protein/RNA complex; complexed with cd, cl, k, mg, na, phe, sr

Details for d3cmeu1

PDB Entry: 3cme (more details), 2.95 Å

PDB Description: the structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (U:) 50S ribosomal protein L24e

SCOPe Domain Sequences for d3cmeu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cmeu1 i.1.1.2 (U:4-56) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOPe Domain Coordinates for d3cmeu1:

Click to download the PDB-style file with coordinates for d3cmeu1.
(The format of our PDB-style files is described here.)

Timeline for d3cmeu1: