![]() | Class i: Low resolution protein structures [58117] (26 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.2: Large subunit [58124] (1 protein) |
![]() | Protein 50S subunit [58125] (6 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
![]() | Domain d3cmet1: 3cme T:1-119 [156826] Other proteins in same PDB: d3cme21, d3cmeb1, d3cmef1, d3cmeg1, d3cmeh1, d3cmei1, d3cmep1, d3cmer1, d3cmes1, d3cmey1, d3cmez1 automatically matched to d1w2bs_ complexed with 1ma, 8an, aca, cd, cl, k, mg, na, omg, omu, phe, psu, sr, ur3 |
PDB Entry: 3cme (more details), 2.95 Å
SCOP Domain Sequences for d3cmet1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cmet1 i.1.1.2 (T:1-119) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]} skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
Timeline for d3cmet1: