Lineage for d3cmer1 (3cme R:1-150)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860696Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 860697Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 860698Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 860699Protein Ribosomal protein L22 [54845] (5 species)
  7. 860700Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
    Uniprot P10970
  8. 860754Domain d3cmer1: 3cme R:1-150 [156824]
    Other proteins in same PDB: d3cme11, d3cme21, d3cme31, d3cmeb1, d3cmed1, d3cmef1, d3cmeg1, d3cmeh1, d3cmei1, d3cmej1, d3cmek1, d3cmel1, d3cmen1, d3cmeo1, d3cmep1, d3cmeq1, d3cmes1, d3cmet1, d3cmeu1, d3cmev1, d3cmew1, d3cmex1, d3cmey1, d3cmez1
    automatically matched to d1ffko_
    complexed with 1ma, 8an, aca, cd, cl, k, mg, na, omg, omu, phe, psu, sr, ur3

Details for d3cmer1

PDB Entry: 3cme (more details), 2.95 Å

PDB Description: the structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (R:) 50S ribosomal protein L22P

SCOP Domain Sequences for d3cmer1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cmer1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOP Domain Coordinates for d3cmer1:

Click to download the PDB-style file with coordinates for d3cmer1.
(The format of our PDB-style files is described here.)

Timeline for d3cmer1: