| Class i: Low resolution protein structures [58117] (26 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.2: Large subunit [58124] (1 protein) |
| Protein 50S subunit [58125] (6 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
| Domain d3cmeq1: 3cme Q:1-95 [156823] Other proteins in same PDB: d3cme21, d3cmeb1, d3cmef1, d3cmeg1, d3cmeh1, d3cmei1, d3cmep1, d3cmer1, d3cmes1, d3cmey1, d3cmez1 automatically matched to d1w2bp_ complexed with 1ma, 8an, aca, cd, cl, k, mg, na, omg, omu, phe, psu, sr, ur3 |
PDB Entry: 3cme (more details), 2.95 Å
SCOP Domain Sequences for d3cmeq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cmeq1 i.1.1.2 (Q:1-95) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe
Timeline for d3cmeq1: