Lineage for d3cmeq1 (3cme Q:1-95)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897176Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 897177Protein 50S subunit [58125] (6 species)
  7. 897178Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 897412Domain d3cmeq1: 3cme Q:1-95 [156823]
    Other proteins in same PDB: d3cme21, d3cmeb1, d3cmef1, d3cmeg1, d3cmeh1, d3cmei1, d3cmep1, d3cmer1, d3cmes1, d3cmey1, d3cmez1
    automatically matched to d1w2bp_
    complexed with 1ma, 8an, aca, cd, cl, k, mg, na, omg, omu, phe, psu, sr, ur3

Details for d3cmeq1

PDB Entry: 3cme (more details), 2.95 Å

PDB Description: the structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOP Domain Sequences for d3cmeq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cmeq1 i.1.1.2 (Q:1-95) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOP Domain Coordinates for d3cmeq1:

Click to download the PDB-style file with coordinates for d3cmeq1.
(The format of our PDB-style files is described here.)

Timeline for d3cmeq1: