![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.2: Large subunit [58124] (3 proteins) |
![]() | Protein Prokaryotic (50S subunit) [58125] (3 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
![]() | Domain d3cmen1: 3cme N:1-186 [156820] Other proteins in same PDB: d3cme21, d3cmeb1, d3cmef1, d3cmeg1, d3cmeh1, d3cmei1, d3cmep1, d3cmer1, d3cmes1, d3cmey1, d3cmez1 automatically matched to d1w2bm_ protein/RNA complex; complexed with aca, cd, cl, k, mg, na, phe, sr |
PDB Entry: 3cme (more details), 2.95 Å
SCOPe Domain Sequences for d3cmen1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cmen1 i.1.1.2 (N:1-186) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]} atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll dgdiel
Timeline for d3cmen1: