Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) |
Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries) Uniprot P14122 67-136 |
Domain d3cmei1: 3cme I:66-129 [156816] Other proteins in same PDB: d3cme11, d3cme21, d3cme31, d3cmeb1, d3cmed1, d3cmef1, d3cmeg1, d3cmeh1, d3cmej1, d3cmek1, d3cmel1, d3cmen1, d3cmeo1, d3cmep1, d3cmeq1, d3cmer1, d3cmes1, d3cmet1, d3cmeu1, d3cmev1, d3cmew1, d3cmex1, d3cmey1, d3cmez1 automatically matched to d1s72i_ complexed with 1ma, 8an, aca, cd, cl, k, mg, na, omg, omu, phe, psu, sr, ur3 |
PDB Entry: 3cme (more details), 2.95 Å
SCOP Domain Sequences for d3cmei1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cmei1 a.4.7.1 (I:66-129) Ribosomal protein L11, C-terminal domain {Archaeon Haloarcula marismortui [TaxId: 2238]} gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg tcts
Timeline for d3cmei1: