SCOP 1.75: Domain d3cmei1: 3cme I:66-129

Lineage for d3cmei1 (3cme I:66-129)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
   Uniprot P14122 67-136

8. Domain d3cmei1: 3cme I:66-129 [156816]
   Other proteins in same PDB: d3cme11, d3cme21, d3cme31, d3cmeb1, d3cmed1, d3cmef1, d3cmeg1, d3cmeh1, d3cmej1, d3cmek1, d3cmel1, d3cmen1, d3cmeo1, d3cmep1, d3cmeq1, d3cmer1, d3cmes1, d3cmet1, d3cmeu1, d3cmev1, d3cmew1, d3cmex1, d3cmey1, d3cmez1
   automatically matched to d1s72i_
   complexed with 1ma, 8an, aca, cd, cl, k, mg, na, omg, omu, phe, psu, sr, ur3

Details for d3cmei1

PDB Entry: 3cme, 2.95 Å

PDB Description: the structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (I:) 50S ribosomal protein L11P

SCOP Domain Sequences for d3cmei1:

Sequence; same for both SEQRES and ATOM records:

>d3cmei1 a.4.7.1 (I:66-129) Ribosomal protein L11, C-terminal domain {Archaeon Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tcts

Timeline for d3cmei1:

• d3cmei1 is new in SCOP 1.75
  
• d3cmei1 appears in SCOPe 2.01
  
• d3cmei1 appears in the current release, SCOPe 2.08