Lineage for d3cme21 (3cme 2:1-49)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778337Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 778338Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 778339Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 778340Protein Ribosomal protein L39e [48664] (1 species)
  7. 778341Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 778395Domain d3cme21: 3cme 2:1-49 [156809]
    Other proteins in same PDB: d3cme11, d3cme31, d3cmeb1, d3cmed1, d3cmef1, d3cmeg1, d3cmeh1, d3cmei1, d3cmej1, d3cmek1, d3cmel1, d3cmen1, d3cmeo1, d3cmep1, d3cmeq1, d3cmer1, d3cmes1, d3cmet1, d3cmeu1, d3cmev1, d3cmew1, d3cmex1, d3cmey1, d3cmez1
    automatically matched to 1VQ4 2:1-49
    complexed with 1ma, 8an, aca, cd, cl, k, mg, na, omg, omu, phe, psu, sr, ur3

Details for d3cme21

PDB Entry: 3cme (more details), 2.95 Å

PDB Description: the structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (2:) 50S ribosomal protein L39e

SCOP Domain Sequences for d3cme21:

Sequence, based on SEQRES records: (download)

>d3cme21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d3cme21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

SCOP Domain Coordinates for d3cme21:

Click to download the PDB-style file with coordinates for d3cme21.
(The format of our PDB-style files is described here.)

Timeline for d3cme21: