Lineage for d3cmcr2 (3cmc R:149-312)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2961611Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2961702Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)
  7. 2961713Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (11 PDB entries)
  8. 2961717Domain d3cmcr2: 3cmc R:149-312 [156807]
    Other proteins in same PDB: d3cmco1, d3cmcp1, d3cmcq1, d3cmcr1
    automated match to d1gd1o2
    complexed with edo, g3h, gol, nad, so4

Details for d3cmcr2

PDB Entry: 3cmc (more details), 1.77 Å

PDB Description: Thioacylenzyme intermediate of Bacillus stearothermophilus phosphorylating GAPDH
PDB Compounds: (R:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d3cmcr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cmcr2 d.81.1.1 (R:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
cttnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOPe Domain Coordinates for d3cmcr2:

Click to download the PDB-style file with coordinates for d3cmcr2.
(The format of our PDB-style files is described here.)

Timeline for d3cmcr2: