Lineage for d3cmcq2 (3cmc Q:149-312)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203127Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2203128Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2203219Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (20 species)
  7. 2203230Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (11 PDB entries)
  8. 2203233Domain d3cmcq2: 3cmc Q:149-312 [156805]
    Other proteins in same PDB: d3cmco1, d3cmcp1, d3cmcq1, d3cmcr1
    automated match to d1gd1o2
    complexed with edo, g3h, gol, nad, so4

Details for d3cmcq2

PDB Entry: 3cmc (more details), 1.77 Å

PDB Description: Thioacylenzyme intermediate of Bacillus stearothermophilus phosphorylating GAPDH
PDB Compounds: (Q:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d3cmcq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cmcq2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
cttnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOPe Domain Coordinates for d3cmcq2:

Click to download the PDB-style file with coordinates for d3cmcq2.
(The format of our PDB-style files is described here.)

Timeline for d3cmcq2: