SCOPe 2.05: Domain d3cmco1: 3cmc O:0-148,O:313-333

Lineage for d3cmco1 (3cmc O:0-148,O:313-333)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (11 PDB entries)

8. Domain d3cmco1: 3cmc O:0-148,O:313-333 [156800]
   Other proteins in same PDB: d3cmco2, d3cmcp2, d3cmcq2, d3cmcr2
   automated match to d1gd1o1
   complexed with edo, g3h, gol, nad, so4

Details for d3cmco1

PDB Entry: 3cmc, 1.77 Å

PDB Description: Thioacylenzyme intermediate of Bacillus stearothermophilus phosphorylating GAPDH

PDB Compounds: (O:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d3cmco1:

Sequence; same for both SEQRES and ATOM records:

>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

Timeline for d3cmco1:

• d3cmco1 first appeared in SCOP 1.75
  
• d3cmco1 appears in SCOPe 2.04
  
• d3cmco1 appears in SCOPe 2.06
  
• d3cmco1 appears in the current release, SCOPe 2.08