Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.55: Ribosomal protein L22 [54842] (1 superfamily) beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation |
Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) some topological similarity to prokaryotic ribosomal protein L17 |
Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein) |
Protein Ribosomal protein L22 [54845] (5 species) |
Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries) Uniprot P10970 |
Domain d3cmar1: 3cma R:1-150 [156787] Other proteins in same PDB: d3cma11, d3cma21, d3cma31, d3cmab1, d3cmad1, d3cmaf1, d3cmah1, d3cmai1, d3cmaj1, d3cmak1, d3cmal1, d3cman1, d3cmao1, d3cmap1, d3cmaq1, d3cmas1, d3cmat1, d3cmau1, d3cmav1, d3cmaw1, d3cmax1, d3cmay1, d3cmaz1 automatically matched to d1ffko_ protein/RNA complex; complexed with cd, cl, k, mg, na, phe, sr |
PDB Entry: 3cma (more details), 2.8 Å
SCOPe Domain Sequences for d3cmar1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cmar1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]} gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg eqqgrkpramgrasawnspqvdvelileep
Timeline for d3cmar1: