Lineage for d3cmap1 (3cma P:1-143)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720880Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 2720881Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
    automatically mapped to Pfam PF01280
  5. 2720882Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 2720883Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 2720884Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 2720926Domain d3cmap1: 3cma P:1-143 [156785]
    Other proteins in same PDB: d3cma11, d3cma21, d3cma31, d3cmab1, d3cmad1, d3cmaf1, d3cmah1, d3cmai1, d3cmaj1, d3cmak1, d3cmal1, d3cman1, d3cmao1, d3cmaq1, d3cmar1, d3cmas1, d3cmat1, d3cmau1, d3cmav1, d3cmaw1, d3cmax1, d3cmay1, d3cmaz1
    automatically matched to d1s72p_
    protein/RNA complex; complexed with aca, cd, cl, k, mg, na, phe, sr

Details for d3cmap1

PDB Entry: 3cma (more details), 2.8 Å

PDB Description: the structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (P:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d3cmap1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cmap1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d3cmap1:

Click to download the PDB-style file with coordinates for d3cmap1.
(The format of our PDB-style files is described here.)

Timeline for d3cmap1: