![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily) multihelical; consists of two different 3-helical domains connected by a long, partly helical linker |
![]() | Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) ![]() automatically mapped to Pfam PF01280 |
![]() | Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein) |
![]() | Protein Ribosomal protein L19 (L19e) [48142] (1 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries) Uniprot P14119 |
![]() | Domain d3cmap1: 3cma P:1-143 [156785] Other proteins in same PDB: d3cma11, d3cma21, d3cma31, d3cmab1, d3cmad1, d3cmaf1, d3cmah1, d3cmai1, d3cmaj1, d3cmak1, d3cmal1, d3cman1, d3cmao1, d3cmaq1, d3cmar1, d3cmas1, d3cmat1, d3cmau1, d3cmav1, d3cmaw1, d3cmax1, d3cmay1, d3cmaz1 automatically matched to d1s72p_ protein/RNA complex; complexed with aca, cd, cl, k, mg, na, phe, sr |
PDB Entry: 3cma (more details), 2.8 Å
SCOPe Domain Sequences for d3cmap1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cmap1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]} tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr dlydkagggefdsvadleryida
Timeline for d3cmap1: