SCOPe 2.07: Domain d3cmai1: 3cma I:66-129

Lineage for d3cmai1 (3cma I:66-129)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
   Uniprot P14122 67-136

8. Domain d3cmai1: 3cma I:66-129 [156779]
   Other proteins in same PDB: d3cma11, d3cma21, d3cma31, d3cmab1, d3cmad1, d3cmaf1, d3cmah1, d3cmaj1, d3cmak1, d3cmal1, d3cman1, d3cmao1, d3cmap1, d3cmaq1, d3cmar1, d3cmas1, d3cmat1, d3cmau1, d3cmav1, d3cmaw1, d3cmax1, d3cmay1, d3cmaz1
   automatically matched to d1s72i_
   protein/RNA complex; complexed with aca, cd, cl, k, mg, na, phe, sr

Details for d3cmai1

PDB Entry: 3cma, 2.8 Å

PDB Description: the structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d3cmai1:

Sequence; same for both SEQRES and ATOM records:

>d3cmai1 a.4.7.1 (I:66-129) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tcts

Timeline for d3cmai1:

• d3cmai1 first appeared in SCOP 1.75
  
• d3cmai1 appears in SCOPe 2.06
  
• d3cmai1 appears in the current release, SCOPe 2.08