Lineage for d3cmai1 (3cma I:66-129)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695423Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2695424Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2695425Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2695473Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
    Uniprot P14122 67-136
  8. 2695502Domain d3cmai1: 3cma I:66-129 [156779]
    Other proteins in same PDB: d3cma11, d3cma21, d3cma31, d3cmab1, d3cmad1, d3cmaf1, d3cmah1, d3cmaj1, d3cmak1, d3cmal1, d3cman1, d3cmao1, d3cmap1, d3cmaq1, d3cmar1, d3cmas1, d3cmat1, d3cmau1, d3cmav1, d3cmaw1, d3cmax1, d3cmay1, d3cmaz1
    automatically matched to d1s72i_
    protein/RNA complex; complexed with aca, cd, cl, k, mg, na, phe, sr

Details for d3cmai1

PDB Entry: 3cma (more details), 2.8 Å

PDB Description: the structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d3cmai1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cmai1 a.4.7.1 (I:66-129) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tcts

SCOPe Domain Coordinates for d3cmai1:

Click to download the PDB-style file with coordinates for d3cmai1.
(The format of our PDB-style files is described here.)

Timeline for d3cmai1: