![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.3: L30e-like [55315] (4 families) ![]() |
![]() | Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
![]() | Protein Ribosomal protein L7ae [55319] (7 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries) Uniprot P12743 |
![]() | Domain d3cmaf1: 3cma F:1-119 [156777] Other proteins in same PDB: d3cma11, d3cma21, d3cma31, d3cmab1, d3cmad1, d3cmah1, d3cmai1, d3cmaj1, d3cmak1, d3cmal1, d3cman1, d3cmao1, d3cmap1, d3cmaq1, d3cmar1, d3cmas1, d3cmat1, d3cmau1, d3cmav1, d3cmaw1, d3cmax1, d3cmay1, d3cmaz1 automatically matched to d1s72f_ protein/RNA complex; complexed with cd, cl, k, mg, na, phe, sr |
PDB Entry: 3cma (more details), 2.8 Å
SCOPe Domain Sequences for d3cmaf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cmaf1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]} pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr
Timeline for d3cmaf1: