SCOPe 2.08: Domain d3cma21: 3cma 2:1-49

Lineage for d3cma21 (3cma 2:1-49)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family)
   interrupted alpha-helix
   automatically mapped to Pfam PF00832

5. Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)

6. Protein Ribosomal protein L39e [48664] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
   Uniprot P22452

8. Domain d3cma21: 3cma 2:1-49 [156773]
   Other proteins in same PDB: d3cma11, d3cma31, d3cmab1, d3cmad1, d3cmaf1, d3cmah1, d3cmai1, d3cmaj1, d3cmak1, d3cmal1, d3cman1, d3cmao1, d3cmap1, d3cmaq1, d3cmar1, d3cmas1, d3cmat1, d3cmau1, d3cmav1, d3cmaw1, d3cmax1, d3cmay1, d3cmaz1
   automatically matched to 1VQ4 2:1-49
   protein/RNA complex; complexed with aca, cd, cl, k, mg, na, phe, sr

Details for d3cma21

PDB Entry: 3cma, 2.8 Å

PDB Description: the structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (2:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d3cma21:

Sequence, based on SEQRES records:

>d3cma21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records):

>d3cma21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

Timeline for d3cma21:

• d3cma21 first appeared in SCOP 1.75
  
• d3cma21 appears in SCOPe 2.07