Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (3 proteins) |
Protein Prokaryotic (50S subunit) [58125] (3 species) |
Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
Domain d3cma11: 3cma 1:1-56 [156772] Other proteins in same PDB: d3cma21, d3cmab1, d3cmaf1, d3cmah1, d3cmai1, d3cmap1, d3cmar1, d3cmas1, d3cmay1, d3cmaz1 automatically matched to d1w2bz_ protein/RNA complex; complexed with aca, cd, cl, k, mg, na, phe, sr |
PDB Entry: 3cma (more details), 2.8 Å
SCOPe Domain Sequences for d3cma11:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cma11 i.1.1.2 (1:1-56) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]} tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
Timeline for d3cma11: