Lineage for d3cma11 (3cma 1:1-56)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897176Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 897177Protein 50S subunit [58125] (6 species)
  7. 897178Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 897349Domain d3cma11: 3cma 1:1-56 [156772]
    Other proteins in same PDB: d3cma21, d3cmab1, d3cmaf1, d3cmah1, d3cmai1, d3cmap1, d3cmar1, d3cmas1, d3cmay1, d3cmaz1
    automatically matched to d1w2bz_
    complexed with 1ma, 8an, aca, cd, cl, k, mg, na, omg, omu, phe, psu, sr, ur3

Details for d3cma11

PDB Entry: 3cma (more details), 2.8 Å

PDB Description: the structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (1:) 50S ribosomal protein L37e

SCOP Domain Sequences for d3cma11:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cma11 i.1.1.2 (1:1-56) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOP Domain Coordinates for d3cma11:

Click to download the PDB-style file with coordinates for d3cma11.
(The format of our PDB-style files is described here.)

Timeline for d3cma11: