Lineage for d3cm4a2 (3cm4 A:2-281)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1147695Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1148695Family c.1.10.6: NeuB-like [110368] (2 proteins)
    Pfam PF03102
  6. 1148696Protein Capsule biosynthesis protein SiaC, N-terminal domain [117380] (1 species)
  7. 1148697Species Neisseria meningitidis [TaxId:487] [117381] (4 PDB entries)
    Uniprot Q57265
  8. 1148699Domain d3cm4a2: 3cm4 A:2-281 [156771]
    Other proteins in same PDB: d3cm4a1
    automatically matched to d1xuua2
    complexed with mlt

Details for d3cm4a2

PDB Entry: 3cm4 (more details), 1.85 Å

PDB Description: crystal structure of metal-free sialic acid synthase (neub) from neisseria meningitidis in complex with malate
PDB Compounds: (A:) Capsule biosynthesis protein

SCOPe Domain Sequences for d3cm4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cm4a2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]}
qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived
emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq
rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh
ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm
drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag

SCOPe Domain Coordinates for d3cm4a2:

Click to download the PDB-style file with coordinates for d3cm4a2.
(The format of our PDB-style files is described here.)

Timeline for d3cm4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cm4a1