| Class b: All beta proteins [48724] (178 folds) |
| Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.1: AFP III-like domain [51269] (2 families) ![]() duplication: consists of two structural repeats related by pseudo dyad |
| Family b.85.1.1: AFP III-like domain [51270] (4 proteins) Pfam PF01354 |
| Protein Capsule biosynthesis protein SiaC, C-terminal domain [117330] (2 species) |
| Species Neisseria meningitidis [TaxId:487] [117331] (4 PDB entries) Uniprot Q57265 |
| Domain d3cm4a1: 3cm4 A:282-349 [156770] Other proteins in same PDB: d3cm4a2 automated match to d1xuua1 complexed with mlt |
PDB Entry: 3cm4 (more details), 1.85 Å
SCOPe Domain Sequences for d3cm4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cm4a1 b.85.1.1 (A:282-349) Capsule biosynthesis protein SiaC, C-terminal domain {Neisseria meningitidis [TaxId: 487]}
ekptkdfafasvvadkdikkgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkga
qikktdie
Timeline for d3cm4a1: