Lineage for d3cm4a1 (3cm4 A:282-349)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1139618Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1139619Superfamily b.85.1: AFP III-like domain [51269] (1 family) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. 1139620Family b.85.1.1: AFP III-like domain [51270] (4 proteins)
    Pfam PF01354
  6. 1139621Protein Capsule biosynthesis protein SiaC, C-terminal domain [117330] (1 species)
  7. 1139622Species Neisseria meningitidis [TaxId:487] [117331] (4 PDB entries)
    Uniprot Q57265
  8. 1139624Domain d3cm4a1: 3cm4 A:282-349 [156770]
    Other proteins in same PDB: d3cm4a2
    automatically matched to d1xuua1
    complexed with mlt

Details for d3cm4a1

PDB Entry: 3cm4 (more details), 1.85 Å

PDB Description: crystal structure of metal-free sialic acid synthase (neub) from neisseria meningitidis in complex with malate
PDB Compounds: (A:) Capsule biosynthesis protein

SCOPe Domain Sequences for d3cm4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cm4a1 b.85.1.1 (A:282-349) Capsule biosynthesis protein SiaC, C-terminal domain {Neisseria meningitidis [TaxId: 487]}
ekptkdfafasvvadkdikkgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkga
qikktdie

SCOPe Domain Coordinates for d3cm4a1:

Click to download the PDB-style file with coordinates for d3cm4a1.
(The format of our PDB-style files is described here.)

Timeline for d3cm4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cm4a2