Lineage for d3clza1 (3clz A:416-617)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813146Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 813147Superfamily b.122.1: PUA domain-like [88697] (13 families) (S)
  5. 813337Family b.122.1.12: SRA domain-like [159368] (1 protein)
    Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA
  6. 813338Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species)
  7. 813339Species Human (Homo sapiens) [TaxId:9606] [159370] (4 PDB entries)
    Uniprot Q96T88 409-615! Uniprot Q96T88 414-617
  8. 813343Domain d3clza1: 3clz A:416-617 [156766]
    automatically matched to 3BI7 A:414-617
    complexed with 5cm

Details for d3clza1

PDB Entry: 3clz (more details), 2.2 Å

PDB Description: The set and ring associated (SRA) domain of UHRF1 bound to methylated DNA
PDB Compounds: (A:) E3 ubiquitin-protein ligase UHRF1

SCOP Domain Sequences for d3clza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3clza1 b.122.1.12 (A:416-617) E3 ubiquitin-protein ligase UHRF1 {Human (Homo sapiens) [TaxId: 9606]}
nhygpipgipvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvdhgnf
ftytgsggrdlsgnkrtaeqscdqkltntnralalncfapindqegaeakdwrsgkpvrv
vrnvkggknskyapaegnrydgiykvvkywpekgksgflvwryllrrdddepgpwtkegk
drikklgltmqypegylealan

SCOP Domain Coordinates for d3clza1:

Click to download the PDB-style file with coordinates for d3clza1.
(The format of our PDB-style files is described here.)

Timeline for d3clza1: