SCOP 1.75: Domain d3cltd2: 3clt D:196-318

Lineage for d3cltd2 (3clt D:196-318)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein)
   lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain

6. Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species)

7. Species Methylophilus methylotrophus [TaxId:17] [82379] (6 PDB entries)

8. Domain d3cltd2: 3clt D:196-318 [156762]
   Other proteins in same PDB: d3cltc1, d3cltd1
   automatically matched to d1o96b2
   complexed with amp, fad; mutant

Details for d3cltd2

PDB Entry: 3clt, 2 Å

PDB Description: crystal structure of the r236e mutant of methylophilus methylotrophus etf

PDB Compounds: (D:) Electron transfer flavoprotein subunit alpha

SCOP Domain Sequences for d3cltd2:

Sequence; same for both SEQRES and ATOM records:

>d3cltd2 c.31.1.2 (D:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]}
didittvdfimsigrgigeetnveqfreladeagatlccsepiadagwlpksrqvgqsgk
vvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftiakygivadifdieeelk
aql

Timeline for d3cltd2:

• d3cltd2 is new in SCOP 1.75
  
• d3cltd2 appears in SCOPe 2.01
  
• d3cltd2 appears in the current release, SCOPe 2.08