Lineage for d3cltc_ (3clt C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861418Family c.26.2.3: ETFP subunits [52432] (3 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 2861440Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species)
    binds AMP
  7. 2861445Species Methylophilus methylotrophus [TaxId:17] [82363] (8 PDB entries)
  8. 2861452Domain d3cltc_: 3clt C: [156760]
    Other proteins in same PDB: d3cltd1, d3cltd2
    automated match to d1o96a_
    complexed with amp, fad; mutant

Details for d3cltc_

PDB Entry: 3clt (more details), 2 Å

PDB Description: crystal structure of the r236e mutant of methylophilus methylotrophus etf
PDB Compounds: (C:) Electron transfer flavoprotein subunit beta

SCOPe Domain Sequences for d3cltc_:

Sequence, based on SEQRES records: (download)

>d3cltc_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyipekgra
tmiegtiseqaakiiqiinefkg

Sequence, based on observed residues (ATOM records): (download)

>d3cltc_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryastkpieevsladiglsandvgaaqsmsrvrrmyipekgratmiegtis
eqaakiiqiinefkg

SCOPe Domain Coordinates for d3cltc_:

Click to download the PDB-style file with coordinates for d3cltc_.
(The format of our PDB-style files is described here.)

Timeline for d3cltc_: