Lineage for d3clsd1 (3cls D:1-191)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861418Family c.26.2.3: ETFP subunits [52432] (3 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 2861419Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
    contains an additional FAD-binding domain of DHS-like fold
  7. 2861423Species Methylophilus methylotrophus [TaxId:17] [82362] (8 PDB entries)
  8. 2861427Domain d3clsd1: 3cls D:1-191 [156758]
    Other proteins in same PDB: d3clsc_, d3clsd2
    automated match to d1o96b1
    complexed with amp, fad; mutant

Details for d3clsd1

PDB Entry: 3cls (more details), 1.65 Å

PDB Description: crystal structure of the r236c mutant of etf from methylophilus methylotrophus
PDB Compounds: (D:) Electron transfer flavoprotein subunit alpha

SCOPe Domain Sequences for d3clsd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3clsd1 c.26.2.3 (D:1-191) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]}
skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
srsqnkdyvev

SCOPe Domain Coordinates for d3clsd1:

Click to download the PDB-style file with coordinates for d3clsd1.
(The format of our PDB-style files is described here.)

Timeline for d3clsd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3clsd2
View in 3D
Domains from other chains:
(mouse over for more information)
d3clsc_