![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.3: ETFP subunits [52432] (3 proteins) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
![]() | Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species) binds AMP |
![]() | Species Methylophilus methylotrophus [TaxId:17] [82363] (8 PDB entries) |
![]() | Domain d3clsc_: 3cls C: [156757] Other proteins in same PDB: d3clsd1, d3clsd2 automated match to d1o96a_ complexed with amp, fad; mutant |
PDB Entry: 3cls (more details), 1.65 Å
SCOPe Domain Sequences for d3clsc_:
Sequence, based on SEQRES records: (download)
>d3clsc_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyipekgra tmiegtiseqaakiiqiinefk
>d3clsc_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl tiqlginkpryastkpieevsladiglsandvgaaqsmsrvrrmyipekgratmiegtis eqaakiiqiinefk
Timeline for d3clsc_: