Lineage for d1qgwd_ (1qgw D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718119Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1718277Protein Phycoerythrin beta subunit [88513] (4 species)
  7. 1718278Species Cryptophyte (Rhodomonas sp. CS24) [TaxId:79257] [46544] (3 PDB entries)
    Uniprot P27198
  8. 1718284Domain d1qgwd_: 1qgw D: [15674]
    Other proteins in same PDB: d1qgwa_, d1qgwb_
    complexed with cl, dbv, mg, peb

Details for d1qgwd_

PDB Entry: 1qgw (more details), 1.63 Å

PDB Description: crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas cs24
PDB Compounds: (D:) protein (cryptophytan phycoerythrin (beta chain))

SCOPe Domain Sequences for d1qgwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgwd_ a.1.1.3 (D:) Phycoerythrin beta subunit {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]}
mldafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmi
cenpslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketyssl
gvpansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais

SCOPe Domain Coordinates for d1qgwd_:

Click to download the PDB-style file with coordinates for d1qgwd_.
(The format of our PDB-style files is described here.)

Timeline for d1qgwd_: