SCOP 1.65: Domain d1qgwd_: 1qgw D:

Lineage for d1qgwd_ (1qgw D:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycoerythrin beta subunit [88513] (4 species)

7. Species Cryptophite (Rhodomonas sp.), cs24 [46544] (1 PDB entry)

8. Domain d1qgwd_: 1qgw D: [15674]
   Other proteins in same PDB: d1qgwa_, d1qgwb_
   complexed with cl, dbv, mo6, peb

Details for d1qgwd_

PDB Entry: 1qgw, 1.63 Å

PDB Description: crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas cs24

SCOP Domain Sequences for d1qgwd_:

Sequence; same for both SEQRES and ATOM records:

>d1qgwd_ a.1.1.3 (D:) Phycoerythrin beta subunit {Cryptophite (Rhodomonas sp.), cs24}
mldafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmi
cenpslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketyssl
gvpansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais

Timeline for d1qgwd_:

• d1qgwd_ first appeared (with stable ids) in SCOP 1.55
  
• d1qgwd_ appears in SCOP 1.63
  
• d1qgwd_ appears in SCOP 1.67
  
• d1qgwd_ appears in the current release, SCOPe 2.08