Lineage for d1qgwd_ (1qgw D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 737Family a.1.1.3: Phycocyanins [46532] (5 proteins)
  6. 765Protein Phycoerythrin [46540] (5 species)
  7. 766Species Cryptophite (Rhodomonas sp.), cs24 [46544] (1 PDB entry)
  8. 768Domain d1qgwd_: 1qgw D: [15674]
    Other proteins in same PDB: d1qgwa_, d1qgwb_

Details for d1qgwd_

PDB Entry: 1qgw (more details), 1.63 Å

PDB Description: crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas cs24

SCOP Domain Sequences for d1qgwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgwd_ a.1.1.3 (D:) Phycoerythrin {Cryptophite (Rhodomonas sp.), cs24}
mldafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmi
cenpslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketyssl
gvpansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais

SCOP Domain Coordinates for d1qgwd_:

Click to download the PDB-style file with coordinates for d1qgwd_.
(The format of our PDB-style files is described here.)

Timeline for d1qgwd_: