Lineage for d3ckia_ (3cki A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964179Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (2 proteins)
    automatically mapped to Pfam PF13574
    automatically mapped to Pfam PF13583
  6. 2964180Protein TNF-alpha converting enzyme, TACE, catalytic domain [55526] (1 species)
  7. 2964181Species Human (Homo sapiens) [TaxId:9606] [55527] (20 PDB entries)
  8. 2964215Domain d3ckia_: 3cki A: [156738]
    Other proteins in same PDB: d3ckib_
    automated match to d1bkce_
    complexed with na, zn

Details for d3ckia_

PDB Entry: 3cki (more details), 2.3 Å

PDB Description: crystal structure of the tace-n-timp-3 complex
PDB Compounds: (A:) adam 17

SCOPe Domain Sequences for d3ckia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ckia_ d.92.1.10 (A:) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiq
ieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlf
tyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltke
adlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsi
yktieskaqecfqers

SCOPe Domain Coordinates for d3ckia_:

Click to download the PDB-style file with coordinates for d3ckia_.
(The format of our PDB-style files is described here.)

Timeline for d3ckia_: