Lineage for d3ckca_ (3ckc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2333995Family a.118.8.6: SusD-like [158775] (4 proteins)
    TPR-like structure resides in the N-terminal part; the C-terminal part is structurally unique and is covered by Pfam PF07980
  6. 2333996Protein Starch utilization system protein SusD [158780] (1 species)
  7. 2333997Species Bacteroides thetaiotaomicron [TaxId:818] [158781] (5 PDB entries)
    Uniprot Q8A1G2 42-551
  8. 2333998Domain d3ckca_: 3ckc A: [156736]
    automated match to d3ck7a1
    complexed with ca, edo, mes, peg

Details for d3ckca_

PDB Entry: 3ckc (more details), 1.5 Å

PDB Description: b. thetaiotaomicron susd
PDB Compounds: (A:) SusD

SCOPe Domain Sequences for d3ckca_:

Sequence, based on SEQRES records: (download)

>d3ckca_ a.118.8.6 (A:) Starch utilization system protein SusD {Bacteroides thetaiotaomicron [TaxId: 818]}
sfdqqgvfvkgyamlgvtgqkgidgspdldgqdegesgfyrttfncnelptdeclwawqk
nqdipqltsiswspssqrtewvyvrlgyditqynffldqtegmtdaetlrqraeirflra
lhywyfldlfgkapfkehfsndlpvekkgtelytyiqnelneieadmyeprqapfgradk
aanwllrarlylnagvytgqtdyakaeeyaskvigsayklctnyselfmadndenenamq
eiilpirqdgvktrnyggstylvcgtrvagmprmgttngwscifaraamvqkffsnledv
pmlpadveiptkgldtdeqidafdaehgirtedmikaagddrallysgvgggrrkiqtda
isgftdglsivkwqnyrsdgkpvshatypdtdiplfrlaeayltraeaifrqggdatgdi
nelrkranctrkvqtvteqelidewarefylegrrrsdlvrfgmfttnkylwdwkggamn
gtsvasyynkypipvsdinnnrnmsqnegyk

Sequence, based on observed residues (ATOM records): (download)

>d3ckca_ a.118.8.6 (A:) Starch utilization system protein SusD {Bacteroides thetaiotaomicron [TaxId: 818]}
sfdqqgvfvkgyamlgvtgdgqdegesgfyrttfncnelptdeclwawqknqdipqltsi
swspssqrtewvyvrlgyditqynffldqtegmtdaetlrqraeirflralhywyfldlf
gkapfkehfsndlpvekkgtelytyiqnelneieadmyeprqapfgradkaanwllrarl
ylnagvytgqtdyakaeeyaskvigsayklctnyselfmadndenenamqeiilpirqdg
vktrnyggstylvcgtrvagmprmgttngwscifaraamvqkffsnledvpmlpadveip
tkgldtdeqidafdaehgirtedmikaagddrallysgvgggrrkiqtdaisgftdglsi
vkwqnyrsdgkpvshatypdtdiplfrlaeayltraeaifrqggdatgdinelrkranct
rkvqtvteqelidewarefylegrrrsdlvrfgmfttnkylwdwkggamngtsvasyynk
ypipvsdinnnrnmsqnegyk

SCOPe Domain Coordinates for d3ckca_:

Click to download the PDB-style file with coordinates for d3ckca_.
(The format of our PDB-style files is described here.)

Timeline for d3ckca_: