![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
![]() | Family a.118.8.6: SusD-like [158775] (4 proteins) TPR-like structure resides in the N-terminal part; the C-terminal part is structurally unique and is covered by Pfam PF07980 |
![]() | Protein Starch utilization system protein SusD [158780] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [158781] (5 PDB entries) Uniprot Q8A1G2 42-551 |
![]() | Domain d3ck9b_: 3ck9 B: [156733] automated match to d3ck7a1 complexed with ca, edo |
PDB Entry: 3ck9 (more details), 2.2 Å
SCOPe Domain Sequences for d3ck9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ck9b_ a.118.8.6 (B:) Starch utilization system protein SusD {Bacteroides thetaiotaomicron [TaxId: 818]} qtggsfdqqgvfvkgyamlgvtgqkgidgspdldgqdegesgfyrttfncnelptdeclw awqknqdipqltsiswspssqrtewvyvrlgyditqynffldqtegmtdaetlrqraeir flralhywyfldlfgkapfkehfsndlpvekkgtelytyiqnelneieadmyeprqapfg radkaanwllrarlylnagvytgqtdyakaeeyaskvigsayklctnyselfmadndene namqeiilpirqdgvktrnyggstylvcgtrvagmprmgttngwscifaraamvqkffsn ledvpmlpadveiptkgldtdeqidafdaehgirtedmikaagddrallysgvgggrrki qtdaisgftdglsivkwqnyrsdgkpvshatypdtdiplfrlaeayltraeaifrqggda tgdinelrkranctrkvqtvteqelidewarefylegrrrsdlvrfgmfttnkylwdwkg gamngtsvasyynkypipvsdinnnrnmsqnegyk
Timeline for d3ck9b_: