Lineage for d3ck8b_ (3ck8 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007546Family a.118.8.6: SusD-like [158775] (4 protein domains)
    TPR-like structure resides in the N-terminal part; the C-terminal part is structurally unique and is covered by Pfam PF07980
  6. 2007547Protein Starch utilization system protein SusD [158780] (1 species)
  7. 2007548Species Bacteroides thetaiotaomicron [TaxId:818] [158781] (5 PDB entries)
    Uniprot Q8A1G2 42-551
  8. 2007552Domain d3ck8b_: 3ck8 B: [156731]
    automated match to d3ck7a1
    complexed with bcd, ca, edo

Details for d3ck8b_

PDB Entry: 3ck8 (more details), 2.1 Å

PDB Description: B. thetaiotaomicron SusD with beta-cyclodextrin
PDB Compounds: (B:) SusD

SCOPe Domain Sequences for d3ck8b_:

Sequence, based on SEQRES records: (download)

>d3ck8b_ a.118.8.6 (B:) Starch utilization system protein SusD {Bacteroides thetaiotaomicron [TaxId: 818]}
qtggsfdqqgvfvkgyamlgvtgqkgidgspdldgqdegesgfyrttfncnelptdeclw
awqknqdipqltsiswspssqrtewvyvrlgyditqynffldqtegmtdaetlrqraeir
flralhywyfldlfgkapfkehfsndlpvekkgtelytyiqnelneieadmyeprqapfg
radkaanwllrarlylnagvytgqtdyakaeeyaskvigsayklctnyselfmadndene
namqeiilpirqdgvktrnyggstylvcgtrvagmprmgttngwscifaraamvqkffsn
ledvpmlpadveiptkgldtdeqidafdaehgirtedmikaagddrallysgvgggrrki
qtdaisgftdglsivkwqnyrsdgkpvshatypdtdiplfrlaeayltraeaifrqggda
tgdinelrkranctrkvqtvteqelidewarefylegrrrsdlvrfgmfttnkylwdwkg
gamngtsvasyynkypipvsdinnnrnmsqnegyk

Sequence, based on observed residues (ATOM records): (download)

>d3ck8b_ a.118.8.6 (B:) Starch utilization system protein SusD {Bacteroides thetaiotaomicron [TaxId: 818]}
qtggsfdqqgvfvkgyamlgvtdegesgfyrttfncnelptdeclwawqknqdipqltsi
swspssqrtewvyvrlgyditqynffldqtegmtdaetlrqraeirflralhywyfldlf
gkapfkehfsndlpvekkgtelytyiqnelneieadmyeprqapfgradkaanwllrarl
ylnagvytgqtdyakaeeyaskvigsayklctnyselfmadndenenamqeiilpirqdg
vktrnyggstylvcgtrvagmprmgttngwscifaraamvqkffsnledvpmlpadveip
tkgldtdeqidafdaehgirtedmikaagddrallysgvgggrrkiqtdaisgftdglsi
vkwqnyrsdgkpvshatypdtdiplfrlaeayltraeaifrqggdatgdinelrkranct
rkvqtvteqelidewarefylegrrrsdlvrfgmfttnkylwdwkggamngtsvasyynk
ypipvsdinnnrnmsqnegyk

SCOPe Domain Coordinates for d3ck8b_:

Click to download the PDB-style file with coordinates for d3ck8b_.
(The format of our PDB-style files is described here.)

Timeline for d3ck8b_: