Lineage for d1qgwc_ (1qgw C:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 276690Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 276807Protein Phycoerythrin beta subunit [88513] (4 species)
  7. 276808Species Cryptophite (Rhodomonas sp.), cs24 [46544] (1 PDB entry)
  8. 276809Domain d1qgwc_: 1qgw C: [15673]
    Other proteins in same PDB: d1qgwa_, d1qgwb_

Details for d1qgwc_

PDB Entry: 1qgw (more details), 1.63 Å

PDB Description: crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas cs24

SCOP Domain Sequences for d1qgwc_:

Sequence, based on SEQRES records: (download)

>d1qgwc_ a.1.1.3 (C:) Phycoerythrin beta subunit {Cryptophite (Rhodomonas sp.), cs24}
dafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmice
npslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgv
pansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais

Sequence, based on observed residues (ATOM records): (download)

>d1qgwc_ a.1.1.3 (C:) Phycoerythrin beta subunit {Cryptophite (Rhodomonas sp.), cs24}
dafsrvvaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmicenpslis
psgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgvpansna
ravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais

SCOP Domain Coordinates for d1qgwc_:

Click to download the PDB-style file with coordinates for d1qgwc_.
(The format of our PDB-style files is described here.)

Timeline for d1qgwc_: