Lineage for d3cjtn1 (3cjt N:70-139)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984852Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 1984853Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 1984854Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 1984945Species Thermus thermophilus [TaxId:274] [158350] (15 PDB entries)
    Uniprot P36238 70-139! Uniprot P36238 71-137
  8. 1984950Domain d3cjtn1: 3cjt N:70-139 [156722]
    Other proteins in same PDB: d3cjtb2, d3cjtf2, d3cjtj2, d3cjtn2
    automatically matched to 2HGJ L:70-139
    protein/RNA complex; complexed with 2mm, cl, edo, no3, sah, sam

Details for d3cjtn1

PDB Entry: 3cjt (more details), 2.3 Å

PDB Description: ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11
PDB Compounds: (N:) 50S ribosomal protein L11

SCOPe Domain Sequences for d3cjtn1:

Sequence, based on SEQRES records: (download)

>d3cjtn1 a.4.7.1 (N:70-139) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdleaaarmiag
sarsmgvevv

Sequence, based on observed residues (ATOM records): (download)

>d3cjtn1 a.4.7.1 (N:70-139) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ktppasylirkaaglekghkpgrekvgreqvleiakqkmpleaaarmiagsarsmgvevv

SCOPe Domain Coordinates for d3cjtn1:

Click to download the PDB-style file with coordinates for d3cjtn1.
(The format of our PDB-style files is described here.)

Timeline for d3cjtn1: