| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) ![]() |
| Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
| Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) |
| Species Thermus thermophilus [TaxId:274] [158350] (11 PDB entries) Uniprot P36238 70-139! Uniprot P36238 71-137 |
| Domain d3cjtn1: 3cjt N:70-139 [156722] Other proteins in same PDB: d3cjtb2, d3cjtf2, d3cjtj2, d3cjtn2 automatically matched to 2HGJ L:70-139 complexed with 2mm, cl, edo, no3, sah, sam; mutant |
PDB Entry: 3cjt (more details), 2.3 Å
SCOP Domain Sequences for d3cjtn1:
Sequence, based on SEQRES records: (download)
>d3cjtn1 a.4.7.1 (N:70-139) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdleaaarmiag
sarsmgvevv
>d3cjtn1 a.4.7.1 (N:70-139) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ktppasylirkaaglekghkpgrekvgreqvleiakqkmpleaaarmiagsarsmgvevv
Timeline for d3cjtn1: